PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00026.77
Common NameAMTR_s00026p00153500, LOC18438575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 223aa    MW: 25243.5 Da    PI: 6.8967
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00026.77genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.9e-3450104155
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                              ++rlrWtp+LH+rFvea++qLGG+e+AtPk +l++m+v+gLt++hvkSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00026.77  50 RQRLRWTPDLHDRFVEAITQLGGPERATPKGVLKIMGVQGLTIYHVKSHLQKYRL 104
                                              58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.78347107IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-3248105IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1748104IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2551105IPR006447Myb domain, plants
PfamPF002495.6E-952103IPR001005SANT/Myb domain
PfamPF143793.6E-20135180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MHEEIAFVNM LHEGEFSESS SVPQNAHRYL GLPSYSIRSN MASRGGPSTR QRLRWTPDLH  60
DRFVEAITQL GGPERATPKG VLKIMGVQGL TIYHVKSHLQ KYRLAKFIPE SIGGEKIDRN  120
DKEVDADQTA SSRLDIDEAL QMQIEVQKRL NEQAEVQRHL QLRMEAQARY IQKILEEQQQ  180
NEKPSSPTTE GKSLWEKDQV PLFPPLSSEE LSLPCGSPSK RT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848821.11e-165PREDICTED: protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN55e-43PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLW1PK831e-165W1PK83_AMBTC; Uncharacterized protein
STRINGPP1S68_240V6.11e-59(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-58G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]